PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0774s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 779aa    MW: 86628.4 Da    PI: 6.8973
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0774s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.21.5e-23155256199
                             EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEE CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvv 81 
                             f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD ++
  SapurV1A.0774s0040.1.p 155 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFI 240
                             99*****************************7333.34459********************************************** PP

                             EEE-SSSEE..EEEEE-S CS
                      B3  82 Fkldgrsefelvvkvfrk 99 
                             F   + +++el+v+v+r+
  SapurV1A.0774s0040.1.p 241 FL--RGENEELRVGVRRA 256
                             **..3488889****985 PP

2Auxin_resp120.31.5e-39281363183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             a+ha+st+++F+v+Y+Pr+s++eF+v+++++++++k+++s+GmRfkm+fe+e+++e+r++Gt+vg++d+dp rW +SkWr+Lk
  SapurV1A.0774s0040.1.p 281 AWHAVSTGTMFTVYYKPRTSPAEFIVPFDQYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPNRWMDSKWRCLK 363
                             89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.01E-40151284IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.8E-41152270IPR015300DNA-binding pseudobarrel domain
CDDcd100172.03E-21153255No hitNo description
SMARTSM010192.0E-22155257IPR003340B3 DNA binding domain
PfamPF023621.7E-21155256IPR003340B3 DNA binding domain
PROSITE profilePS5086311.603155257IPR003340B3 DNA binding domain
PfamPF065078.0E-37281363IPR010525Auxin response factor
SuperFamilySSF542771.23E-8708778No hitNo description
PROSITE profilePS5174520.49710778IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 779 aa     Download sequence    Send to blast
MKKFEISAKA NSGNIRGGES FSSGYSEAME GQKKHSTHPS SARDAETALY NELWHACAGP  60
LVTVPREGDR VFYFPQGHIE QVEASTNQGA DQQMPLYNLP PKILCRVVNV QLKAEPDTDE  120
VFAQVTLIPE QSQDENKLEK EPPPPPPPRF HVHSFCKTLT ASDTSTHGGF SVLRRHADEC  180
LPPLDMSRQP PTQELVAKDL HGNEWRFRHI FRGQPRRHLL QSGWSVFVSS KRLVAGDAFI  240
FLRGENEELR VGVRRALRQQ GNVPSSVISS HSMHLGVLAT AWHAVSTGTM FTVYYKPRTS  300
PAEFIVPFDQ YMESVKNNYS IGMRFKMRFE GEEAPEQRFT GTIVGIEDAD PNRWMDSKWR  360
CLKVRWDETS TMLRPERVSP WKIEPALAPP ALNPLPLPRP KRPRANMVPS SPDSSVLTRD  420
GSSKVTADPP PASGFSRVLQ GQEFPTLRGT FIGSNDSNAA EQSVMWPPSA DDEKIDVLST  480
SRRFGSERWI SSARHEPTCT DLLSGFGTNA DSSHGFGSPF VDQTAVAANS KKKHLSDQGQ  540
FNLLSSPWSI MSSGLVLKLS ESNTKVPVQG NVVTYQARAN VRCSAFSETM PPPPSHFDNH  600
AHLRELMPKP VLMQEHDTGK SLDGNCKLFG IPLKISKPVA PEAAGTTDTV NEPLCHVQPV  660
SHQLTLESDQ KSEQSKGSKM KDENENEKPF QAGHLQTRDS HGKTQNGSTR SCTKVLKQGI  720
ALGRSVDLAK FNNYDELIAE LDRLFEFNGE LMAPQKNWLI VYTDDENDMM LVGDDPWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.04838518354Auxin response factor 1
4ldw_A0.04838518354Auxin response factor 1
4ldw_B0.04838518354Auxin response factor 1
4ldx_A0.04838518354Auxin response factor 1
4ldx_B0.04838518354Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322300.10.0auxin response factor 2 family protein
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLB9IFK30.0B9IFK3_POPTR; Auxin response factor
STRINGPOPTR_0015s11660.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32813366
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2